HORDB

ID: hor005858
Uniprot ID: Q27J49
Protein name: Bradykinin-potentiating peptide 4
Gene name: NA
Organism: Lachesis muta muta (Bushmaster)
Family: Bradykinin-potentiating peptide family; Bradykinin inhibitor peptide family; Natriuretic peptide family
Source: Animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Lachesis muta (species), Lachesis (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0090729 toxin activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: QKKWPPGHHIPP
Length: 12(83-94)
Propeptide: MFVSRLAASGLLLLALLAVSLDGKPVQQWSHKGWPPRPQIPPLVVQQWSQKPWPPGHHIPPVVVQEWPPGHHIPPLVVQQWSQKKWPPGHHIPPLVVQKWDPPPISPPLLKPHESPAGGTTALREELSLGPEAALDTPPAGPDVGPRGSKAPAAPHRLPKSKGASATSAASRPMRDLRTDGKQARQNWGRMMNPDHHAVGGGGGGGGARRLKGLAKKRVGDGCFGLKLDRIGSMSGLGC
Signal peptide: MFVSRLAASGLLLLALLAVSLDG
Modification: T1 Pyrrolidone carboxylic acid
Glycosylation: NA
Mutagenesis: NA

Function: Bradykinin-potentiating peptide both inhibits the activity of the angiotensin-converting enzyme (ACE) and enhances the action of bradykinin by inhibiting the peptidases that inactivate it. It acts as an indirect hypotensive agent (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005858_AF2.pdb

hor005858_ESM.pdb

Mass:	161805	Formula:	C68H100N20O14
Absent amino acids:	ACDEFLMNRSTVY	Common amino acids:	P
pI:	10.81	Basic residues:	4
Polar residues:	1	Hydrophobic residues:	2
Hydrophobicity:	-174.17	Boman Index:	-1777
Half-Life / Aliphatic Index:	0.8 hour	Aliphatic Index:	32.5
Instability Index:	7548.33	Extinction Coefficient cystines:	5500
Absorbance 280nm:	500

PubMed ID: 15876444
Title: Identification of novel bradykinin-potentiating peptides and C-type natriuretic peptide from Lachesis muta venom.
PubMed ID: 16582429
Title: Lachesis muta (Viperidae) cDNAs reveal diverging pit viper molecules and scaffolds typical of cobra (Elapidae) venoms: implications for snak
PubMed ID: 16277978
Title: